Index 
Search
Download
Help
MIX_00330: Heparin-binding growth factor 2 [Precursor]
ID:

MIX_00330
AC:

330
CL:

MIX
DT:

27-MAY-2003
NA:

Heparin-binding growth factor 2 [Precursor]
HBGF-2
Basic fibroblast growth factor
BFGF
Prostatropin
GN:

FGF2
FGF-2
OS:

Cricetulus griseus (Chinese hamster)
CT:

CHO
P1:

7531096 (1994)
P2:

7531096 (1994)
CC:

sequence taken from mouse
SP:

FGF2_MOUSE, P15655
SS:

SWISSPROT/TrEMBL
SI:

154 AA; 17133 Da; calculated pI: 9.58
SQ:

MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVK
LQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYS
SWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab