Index 
Search
Download
Help
MIX_00320: Androgen receptor
ID:

MIX_00320
AC:

320
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Androgen receptor
Dihydrotestosterone receptor
GN:

AR
NR3C4
DHTR
OS:

Homo sapiens (Human)
CT:

prostatic cancer cell, prostatic cell, genital skin fibroblast, cv-1 cell
P1:

3941459 (1986), 11694337 (2001), 6200614 (1984), 6207385 (1984), 6539385 (1984), 3944238 (1986), 10934038 (2000), 6863257 (1983), 3260308 (1988), 6186370 (1983), 12941817 (2003)
P2:

2233749 (1990), 3260308 (1988), 3941459 (1986), 3944238 (1986), 6186370 (1983), 6200614 (1984), 6207385 (1984), 6466649 (1984), 6471235 (1984), 6539385 (1984), 6643487 (1983), 6863257 (1983), 12269826 (2002), 10934038 (2000), 10935541 (2000), 11694337 (2001), 12941817 (2003)
CC:

this NMTS is a close homologue (hssp >= 10) to NMTS found in literature
SP:

ANDR_HUMAN, P10275
PD:

1E3G, 1GS4
SS:

SWISSPROT/TrEMBL
SI:

919 AA; 98877 Da; calculated pI: 6.00
SQ:

MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQ
QQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSA
LECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLK
DILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKA
VSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKS
TEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSR
DYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGP
GSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPY
GYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLE
TARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRND
CTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLT
VSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAK
ALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRM
YSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDR
IIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIIS
VQVPKILSGKVKPIYFHTQ

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab