Index 
Search
Download
Help
MIX_00319: PML protein
ID:

MIX_00319
AC:

319
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

PML protein
GN:

PML
OS:

Homo sapiens (Human)
P1:

9031108 (1996), 8545113 (1995), 9395203 (1997), 14712236 (2004)
P2:

8545113 (1995), 9031108 (1996), 9395203 (1997), 7780148 (1995), 11453544 (2001), 11413191 (2001), 14712236 (2004)
CC:

phosphorylated form binds to NM
SP:

Q15959
SS:

SWISSPROT/TrEMBL
SI:

641 AA; 70289 Da; calculated pI: 5.85
SQ:

MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQC
QAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYR
QIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDG
TRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEEL
DAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEA
VDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLR
QEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE
EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCS
QTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLP
NSNHVASGAGEAEERVVVISSSEDSDAENSVSSSPQSEVLYWKVHGAHGDRRATVLASPL
LASPLLASPLLASPVSAESTRSLQPALWHIPPPSLASPPAR

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab