Index 
Search
Download
Help
MIX_00317: Basic fibroblast growth factor receptor 1 [Precursor]
ID:

MIX_00317
AC:

317
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Basic fibroblast growth factor receptor 1 [Precursor]
FGFR-1
bFGF-R
Fms-like tyrosine kinase-2
c-fgr
GN:

FGFR1
FLG
FGFBR
FLT2
OS:

Homo sapiens (Human)
CT:

astrocyte, reactive astrocyte
P1:

8737680 (1996), 9457702 (1997), 14587039 (2003)
P2:

8737680 (1996), 8856671 (1996), 9457702 (1997), 14587039 (2003)
SP:

FGR1_HUMAN, P11362
PD:

1AGW, 1CVS, 1EVT, 1FGI, 1FGK, 1FQ9, 2FGI
SS:

SWISSPROT/TrEMBL
SI:

822 AA; 91763 Da; calculated pI: 5.82
SQ:

MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab