Index 
Search
Download
Help
MIX_00311: Estrogen receptor
ID:

MIX_00311
AC:

311
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Estrogen receptor
ER
Estradiol receptor
ER-alpha
GN:

ESR1
NR3A1
ESR
OS:

Homo sapiens (Human)
CT:

breast cancer cell, spermatozoa
P1:

12123286 (2002), 3186693 (1988), 11964215 (2002), 11682483 (2001), 9950689 (1999)
P2:

2004602 (1991), 2318161 (1990), 3186693 (1988), 6430682 (1984), 6643487 (1983), 12351687 (2002), 11682483 (2001), 11964215 (2002), 12123286 (2002), 9950689 (1999)
CC:

this NMTS is a close homologue (hssp >= 10) to NMTS found in literature
SP:

ESR1_HUMAN, P03372
PD:

1A52, 1AKF, 1ERE, 1ERR, 1G50, 1GWQ, 1GWR, 1HCP, 1HCQ, 1L2I, 1QKT, 1QKU, 3ERD, 3ERT
SS:

SWISSPROT/TrEMBL
SI:

595 AA; 66140 Da; calculated pI: 8.30
SQ:

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab