Index 
Search
Download
Help
MIX_00306: Estrogen receptor
ID:

MIX_00306
AC:

306
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Estrogen receptor
ER
Estradiol receptor
ER-alpha
GN:

ESR1
NR3A1
ESR
ESTR
ESTRA
OS:

Mus musculus (Mouse)
CT:

uterine cell
P1:

2318161 (1990), 2004602 (1991)
P2:

2004602 (1991), 2318161 (1990), 3186693 (1988), 6430682 (1984), 6643487 (1983), 12351687 (2002), 11682483 (2001), 11964215 (2002), 12123286 (2002)
CC:

this NMTS is a close homologue (hssp >= 10) to NMTS found in literature
SP:

ESR1_MOUSE, P19785
SS:

SWISSPROT/TrEMBL
SI:

599 AA; 66878 Da; calculated pI: 8.30
SQ:

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAY
EFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQ
LSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIM
ESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKS
CQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPL
VIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVH
MINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGK
CVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIH
RVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPL
YDLLLEMLDAHRLHAPASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab