Index 
Search
Download
Help
MIX_00304: Estrogen receptor
ID:

MIX_00304
AC:

304
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Estrogen receptor
ER
Estradiol receptor
ER-alpha
GN:

ESR1
NR3A1
ESR
ESTR
OS:

Rattus norvegicus (Rat)
CT:

liver, prostate cell, uterine cell
P1:

6430682 (1984), 6643487 (1983)
P2:

2004602 (1991), 2318161 (1990), 3186693 (1988), 6430682 (1984), 6643487 (1983), 12351687 (2002), 11682483 (2001), 11964215 (2002), 12123286 (2002)
CC:

this NMTS is a close homologue (hssp >= 10) to NMTS found in literature
SP:

ESR1_RAT, P06211
SS:

SWISSPROT/TrEMBL
SI:

600 AA; 66953 Da; calculated pI: 8.30
SQ:

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPAVFNYPEGAAY
EFNAAAAAAAAGASAPVYGQSSITYGPGSEAAAFGANSLGAFPQLNSVSPSPLMLLHPPP
HVSPFLHPHGHQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSSEKGNMI
MESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRK
SCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGTSGDMRAANLWPSP
LVIKHTKKNSPALSLTADQMVSALLDAEPPLIYSEYDPSRPFSEASMMGLLTNLADRELV
HMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQG
KCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHI
HRVLDKINDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVP
LYDLLLEMLDAHRLHAPASRMGVPPEEPSQSQLTTTSSTSAHSLQTYYIPPEAEGFPNTI

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab