Index 
Search
Download
Help
MIX_00302: Glucocorticoid receptor
ID:

MIX_00302
AC:

302
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Glucocorticoid receptor
GR
GN:

NR3C1
GRL
OS:

Rattus norvegicus (Rat)
CT:

hippocampus cell, liver,
P1:

1659997 (1991), 3528149 (1962), 2717578 (1989), 9731709 (1998)
P2:

1659997 (1991), 2717578 (1989), 3528149 (1962), 3729932 (1986), 8628265 (2001), 10813393 (2000), 9353307 (1997), 9731709 (1998), 12024025 (2002), 10848625 (2007)
CC:

407-574 is minimal NMTS (according to paper)
SP:

GCR_RAT, P06536
PD:

1GDC, 1GLU, 1RGD, 2GDA
SS:

SWISSPROT/TrEMBL
SI:

795 AA; 87457 Da; calculated pI: 6.38
SQ:

MDSKESLAPPGRDEVPGSLLGQGRGSVMDFYKSLRGGATVKVSASSPSVAAASQADSKQQ
RILLDFSKGSTSNVQQRQQQQQQQQQQQQQQQQQQQPDLSKAVSLSMGLYMGETETKVMG
NDLGYPQQGQLGLSSGETDFRLLEESIANLNRSTSVPENPKSSTSATGCATPTEKEFPKT
HSDASSEQQNRKSQTGTNGGSVKLYPTDQSTFDLLKDLEFSAGSPSKDTNESPWRSDLLI
DENLLSPLAGEDDPFLLEGNTNEDCKPLILPDTKPKIKDTGDTILSSPSSVALPQVKTEK
DDFIELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMYHYDMNTAS
LSQQQDQKPVFNVIPPIPVGSENWNRCQGSGEDSLTSLGALNFPGRSVFSNGYSSPGMRP
DVSSPPSSSSAATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRN
DCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQDTSENPNKTIVP
AALPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIL
GLRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSGNLLCFAPDLIINEQRMSLPCMYDQ
CKHMLFVSSELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIV
KREGNSSQNWQRFYQLTKLLDSMHEVVENLLTYCFQTFLDKTMSIEFPEMLAEIITNQIP
KYSNGNIKKLLFHQK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab