Index 
Search
Download
Help
MIX_00301: Histone acetyltransferase type B catalytic subunit
ID:

MIX_00301
AC:

301
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Histone acetyltransferase type B catalytic subunit
GN:

HAT1
OS:

Homo sapiens (Human)
CT:

breast cancer cell
P1:

10546890 (1999), 11682483 (2001)
P2:

11682483 (2001), 8077241 (1994), 8083305 (1994), 8575881 (1995), 10546890 (1999), 9291093 (1997), 11435438 (2001), 7993915 (1994)
CC:

sequence taken of catalytic subunit
SP:

HAT1_HUMAN, O14929
SS:

SWISSPROT/TrEMBL
SI:

419 AA; 49456 Da; calculated pI: 5.52
SQ:

MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLF
GDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFC
TNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQT
FLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQ
MLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCF
SREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLI
SPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab