Index 
Search
Download
Help
MIX_00291: Large T antigen
ID:

MIX_00291
AC:

291
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Large T antigen
OS:

sv-40
CT:

transformed mouse cell, monkey Cos, monkey C6
P1:

6302321 (1983), 9702793 (1998), 2539520 (1989), 2822963 (1987), 6095067 (1984), 2674854 (1989)
P2:

2539520 (1989), 2674854 (1989), 2822963 (1987), 3040447 (1987), 6095067 (1984), 6302321 (1983), 9702793 (1998)
SP:

TALA_SV40, P03070
PD:

1EJL, 1GH6, 1N25, 1TBD
SS:

SWISSPROT/TrEMBL
SI:

708 AA; 81489 Da; calculated pI: 5.78
SQ:

MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYK
KMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADS
QHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYS
VTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDP
FSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFE
MCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQM
LTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKR
YWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGG
ESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEFSVPKTLQAR
FVKQIDFRAKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWK
ERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNEDGGEKNMEDSGHE
TGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPTPPPEPET

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab