Index 
Search
Download
Help
MIX_00284: Large T antigen
ID:

MIX_00284
AC:

284
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Large T antigen
OS:

polyoma virus
CT:

mouse 3T6 cell
P1:

3040447 (1987)
P2:

2539520 (1989), 2674854 (1989), 2822963 (1987), 3040447 (1987), 6095067 (1984), 6302321 (1983), 9702793 (1998)
SP:

TALA_POVBK, P03071
SS:

SWISSPROT/TrEMBL
SI:

695 AA; 80413 Da; calculated pI: 6.34
SQ:

MDKVLNREESMELMDLLGLERAAWGNLPLMRKAYLRKCKEFHPDKGGDEDKMKRMNTLYK
KMEQDVKVAHQPDFGTWSSSEVPTYGTEEWESWWSSFNEKWDEDLFCHEDMFASDEEATA
DSQHSTPPKKKRKVEDPKDFPSDLHQFLSQAVFSNRTLACFAVYTTKEKAQILYKKLMEK
YSVTFISRHMCAGHNIIFFLTPHRHRVSAINNFCQKLCTFSFLICKGVNKEYLLYSALTR
DPYHTIEESIQGGLKEHDFSPEEPEETKQVSWKLITEYAVETKCEDVFLLLGMYLEFQYN
VEECKKCQKKDQPYHFKYHEKHFANAIIFAESKNQKSICQQAVDTVLAKKRVDTLHMTRE
EMLTERFNHILDKMDLIFGAHGNAVLEQYMAGVAWLHCLLPKMDSVIFDFLHCIVFNVPK
RRYWLFKGPIDSGKTTLAAGLLDLCGGKALNVNLPMERLTFELGVAIDQYMVVFEDVKGT
GAESKDLPSGHGINNLDSLRDYLDGSVKVNLEKKHLNKRTQIFPPGLVTMNEYPVPKTLQ
ARFVRQIDFRPKIYLRKSLQNSEFLLEKRILQSGMTLLLLLIWFRPVADFATDIQSRIVE
WKERLDSEISMYTFSRMKYNICMGKCILDITREEDSETEDSGHGSSTESQSQCSSQVSDT
SAPAEDSQRSDPHSQELHLCKGFQCFKRPKTPPPK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab