Index 
Search
Download
Help
MIX_00265: Cockayne syndrome WD-repeat protein CSA
ID:

MIX_00265
AC:

265
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Cockayne syndrome WD-repeat protein CSA
GN:

CKN1
CSA
OS:

mammalian
P1:

11782547 (2002)
P2:

11782547 (2002)
CC:

sequence taken from human
SP:

CSA_HUMAN, Q13216
SS:

SWISSPROT/TrEMBL
SI:

396 AA; 44006 Da; calculated pI: 5.91
SQ:

MLGFLSARQTGLEDPLRLRRAESTRRVLGLELNKDRDVERIHGGGINTLDIEPVEGRYML
SGGSDGVIVLYDLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSF
DKTLKVWDTNTLQTADVFNFEETVYSHHMSPVSTKHCLVAVGTRGPKVQLCDLKSGSCSH
ILQGHRQEILAVSWSPRYDYILATASADSRVKLWDVRRASGCLITLDQHNGKKSQAVESA
NTAHNGKVNGLCFTSDGLHLLTVGTDNRMRLWNSSNGENTLVNYGKVCNNSKKGLKFTVS
CGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGHYKTVDCCVFQSNFQELYSGSRDCNILA
WVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab