Index 
Search
Download
Help
MIX_00235: Kruppel-like factor 3
ID:

MIX_00235
AC:

235
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Kruppel-like factor 3
Basic kruppel-like factor
CACCC-box binding protein BKLF
TEF-2
GN:

KLF3
BKLF
OS:

Gallus gallus (Chicken)
CT:

erythrocytes
P1:

8891891 (1996)
P2:

8891891 (1996)
CC:

this NMTS is a close homologue (hssp >= 10) to NMTS found in literature
SP:

KLF3_HUMAN, P57682
SS:

SWISSPROT/TrEMBL
SI:

345 AA; 38784 Da; calculated pI: 9.44
SQ:

MLMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFFQTPEGLSHGIQME
PVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVP
LSMPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMENSSSSM
QVPVIESYEKPISQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQ
PGKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWK
FARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab