Index 
Search
Download
Help
MIX_00230: Methylated-DNA--protein-cysteine methyltransferase
ID:

MIX_00230
AC:

230
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Methylated-DNA--protein-cysteine methyltransferase
6-O-methylguanine-DNA methyltransferase
GN:

MGMT
OS:

Rattus norvegicus (Rat)
CT:

various
P1:

3947377 (1986)
P2:

3947377 (1986)
SP:

MGMT_RAT, P24528
SS:

SWISSPROT/TrEMBL
SI:

208 AA; 22087 Da; calculated pI: 7.85
SQ:

AEICKMKYTVLDSPLGKIELSGCERGLHGIRFLSGKTPNTDPTEAPACPEVLGGPEGVPE
PLVQCTAWLEAYFHEPAATEGLPLPALHHPVFQQDSFTRQVLWKLLKVVKFGEMVSYQQL
AALAGNPKAARAVGGAMRSNPVPILIPCHRVIRSDGAIGNYSGGGQTVKEWLLAHEGIPT
GQPASKGLGLIGSWLKPSFESSSPKPSG

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab