Index 
Search
Download
Help
MIX_00227: Myosin light chain kinase 2, skeletal/cardiac muscle
ID:

MIX_00227
AC:

227
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Myosin light chain kinase 2, skeletal/cardiac muscle
MLCK2
GN:

MYLK2
OS:

Rattus norvegicus (Rat)
CT:

liver
P1:

2211720 (1990), 8384250 (1993)
P2:

2211720 (1990), 8384250 (1993), 6547722 (1984), 3342064 (1988)
SP:

KML2_RAT, P20689
SS:

SWISSPROT/TrEMBL
SI:

609 AA; 65611 Da; calculated pI: 5.05
SQ:

ATENGAVELGTQSLSTDHPPTDAAGDGSPASEKEPSLPDTEKDLGPTNTKKDPGAPDPKK
NPDPPSLKKTPEAPGPEKKGDSAPASASNQGPSGEGDGGGGPAEGGTGPPAVLPQPTATA
DASIQKLDATQAPSGNQESGEAKAGKKAAECREAGRRGSPAFLHSPSCPAIISCSEKTLA
MKPLSETTELIFAGVSETPDPQDPGPAKDEGGTNTLADGKEEAEAGQAEQAKVQGDTSQR
IGFQAVPSERAEVGQALCLTAKEEDCFQILDDCPPPPAPFPHRIVELRTGNVSSEFSMNS
KEALGGGKFGAVCTCTERSTGLKLAAKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLYS
AIETSHEIILFMEYIEGGELFERIVDEDYQLTEVDTMVFVRQICDGILFMHKMRVLHLDL
KPENILCVNTTGHLVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWS
LGVITYMLLSGLSPFLGDDDTETLNNVLSANWYFDEETFEAVSDEAKDFVSNLITKDQSA
RMSAEQCLAHPWLNNLAEKAKRCNRRLKSQILLKKYLMKRRWKKNFIAVSAANRFKKISS
SGALMALGV

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab