Index 
Search
Download
Help
MIX_00188: ATP-dependent DNA helicase II, 80 kDa subunit
ID:

MIX_00188
AC:

188
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

ATP-dependent DNA helicase II, 80 kDa subunit
Lupus Ku autoantigen protein p86
Ku86
Ku80
86 kDa subunit of Ku antigen
Thyroid-lupus autoantigen
TLAA
CTC box binding factor 85 kDa subunit
CTCBF
CTC85
Nuclear factor IV
DNA-repair protein XRCC5
GN:

XRCC5
G22P2
OS:

Homo sapiens (Human)
CT:

HeLa cell
P1:

9873986 (1998)
P2:

9873986 (1998)
SP:

KU86_HUMAN, P13010
PD:

1JEQ, 1JEY
SS:

SWISSPROT/TrEMBL
SI:

731 AA; 82479 Da; calculated pI: 5.55
SQ:

VRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGT
DGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHE
TIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDG
PFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIE
RHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDD
ETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQV
LKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVY
VQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTK
IPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIE
AKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVL
VKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKA
LQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEE
GGDVDDLLDMI

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab