Index 
Search
Download
Help
MIX_00184: Diacylglycerol kinase, alpha
ID:

MIX_00184
AC:

184
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Diacylglycerol kinase, alpha
Diglyceride kinase
DGK-alpha
DAG kinase alpha
DGK-IV
80 kDa diacylglycerol kinase
GN:

DGKA
DAGK1
DAGK
OS:

Rattus norvegicus (Rat)
CT:

liver, thymocyte, peripheral lymphocyte
P1:

1312084 (1992), 8804421 (1996)
P2:

1312084 (1992), 8804421 (1996)
SP:

KDGA_RAT, P51556
SS:

SWISSPROT/TrEMBL
SI:

727 AA; 82198 Da; calculated pI: 6.00
SQ:

MAKDKGLISPEDFAQLQKYIDYSTKSVSDVLKVFEMNKYCQGDEIGYLGFEQFLKMYLEV
EEVPHHLCWTLFWSFHSSQDLDEETESKANVICLSDVYCYFTLLEGGSPEDKLEFTFKLY
DMDRNGILDSTEVEKIILQMMRVAEYLDWDVSELRPILQEMMKEMDRDGSGCVSLAEWVR
AGATTVPLLVLLGIDMTMKDDGHHIWRPKRFSRPVYCNLCELSIGLGKQGLSCNLCKYIV
HDHCAMKAQPCEVSTYAKSRKDIGVQPHVWVRGGCHSGRCDRCQKKIRTYHSLTGLHCVW
CHLEIHDDCLQAVGPECDCGLLRDHILPPCSIYPRVLVSGQECKQKTTDVTSLCTPEAFR
IEPVSNTHPLLVFINPKSGGKQGQSVLWKFQYILNPRQVFNLKDGPEPGLRFFKDVPQFR
VLVCGGDGTVGWILETIDKANFPIVPPVAVLPLGTGNDLARCLRWGRGYEGENLRKILKD
IEISKVVYLDRWLLEVIPQQNGEKSDPVPSQIINNYFSIGVDASIAHRFHLMREKYPEKF
NSRMKNKLWYLEFATSESIFSTCKKLEESVTVEICGKLLDLSDLSLEGIAVLNIPSMHGG
SNLWGDTKRPHGDTCGINQALGSVAKIITDPDILKTCVPDMSDKRLEVVGIEGVIEMGQI
YTRLKSAGHRLAKCSEITFQTTKTLPMQVDGEPWMQAPCTIKITHKNQMPMLMGPAPSSS
NFFGFWS

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab