Index 
Search
Download
Help
MIX_00183: Protein US2
ID:

MIX_00183
AC:

183
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Protein US2
GN:

US2
OS:

hsv-2
P1:

9820154 (1998)
P2:

9820154 (1998)
SP:

US02_HSV2H, P13292
SS:

SWISSPROT/TrEMBL
SI:

291 AA; 32743 Da; calculated pI: 7.61
SQ:

MGVVVVSVVTLLDQRNALPRTSADASPALWSFLLRQCRILASEPLGTPVVVRPANLRRLA
EPLMDLPKFTRPIVRTRSCRCPPNTTTGLFAEDDPLESIEILDAPACFRLLHQERPGPHR
LYHLWVVGAADLCVPFFEYAQKTRLGFRFIATKTNDAWVGEPWPLPDRFLPERTVSWTPF
PAAPNHPLENLLSRYEYQYGVVVPGDRERSCLRWLRSLVAPHNKPRPASSRPHPATHPTQ
RPCFTCMGRPEIPDEPSWQTGDDDPQNPGPPLAVGDEWPPSSHVCYPITNL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab