Index 
Search
Download
Help
MIX_00179: A-kinase anchor protein 8
ID:

MIX_00179
AC:

179
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

A-kinase anchor protein 8
A-kinase anchor protein 95 kDa
AKAP 95
GN:

AKAP8
AKAP95
OS:

Homo sapiens (Human)
CT:

HeLa cell
P1:

10601332 (1999), 10791967 (2000), 11279182 (2001), 14641107 (2004)
P2:

10601332 (1999), 10791967 (2000), 8125992 (1994), 11279182 (2001), 14641107 (2004)
SP:

AKA8_HUMAN, O43823
SS:

SWISSPROT/TrEMBL
SI:

692 AA; 76025 Da; calculated pI: 5.03
SQ:

MDQGYGGYGAWSAGPANTQGAYGTGVASWQGYENYNYYGAQNTSVTTGATYSYGPASWEA
AKANDGGLAAGAPAMHMASYGPEPCTDNSDSLIAKINQRLDMMSKEGGRGGSGGGGEGIQ
DRESSFRFQPFESYDSRPCLPEHNPYRPSYSYDYEFDLGSDRNGSFGGQYSECRDPARER
GSLDGFMRGRGQGRFQDRSNPGTFMRSDPFVPPAASSEPLSTPWNELNYVGGRGLGGPSP
SRPPPSLFSQSMAPDYGVMGMQGAGGYDSTMPYGCGRSQPRMRDRDRPKRRGFDRFGPDG
TGRKRKQFQLYEEPDTKLARVDSEGDFSENDDAAGDFRSGDEEFKGEDELCDSGRQRGEK
EDEDEDVKKRREKQRRRDRTRDRAADRIQFACSVCKFRSFDDEEIQKHLQSKFHKETLRF
ISTKLPDKTVEFLQEYIVNRNKKIEKRRQELMEKETAKPKPDPFKGIGQEHFFKKIEAAH
CLACDMLIPAQPQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVLNNRHIVKMLEKYL
KGEDPFTSETVDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESS
GEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEA
ESAQTRVAPAPAAADAEVEQTDAESKDAVPTE

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab