Index 
Search
Download
Help
MIX_00168: EBNA-6 nuclear protein
ID:

MIX_00168
AC:

168
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

EBNA-6 nuclear protein
EBNA-3C
EBNA-4B
GN:

BERF3-BERF4
OS:

epstein-barr virus
P1:

2161150 (1990)
P2:

2161150 (1990)
SP:

EBN6_EBV, P03204
SS:

SWISSPROT/TrEMBL
SI:

992 AA; 109007 Da; calculated pI: 6.79
SQ:

MESFEGQGDSRQSPDNERGDNVQTTGEHDQDPGPGPPSSGASERLVPEESYSRDQQPWGQ
SRGDENRGWMQRIRRRRRRRAALSGHLLDTEDNVPPWLPPHDITPYTARNIRDAACRAVK
QSHLQALSNLILDSGLDTQHILCFVMAARQRLQDIRRGPLVAEGGVGWRHWLLTSPSQSW
PMGYRTATLRTLTPVPNRVGADSIMLTATFGCQNAARTLNTFSATVWTPPHAGPREQERY
AREAEVRFLRGKWQRRYRRIYDLIELCGSLHHIWQNLLQTEENLLDFVRFMGVMSSCNNP
AVNYWFHKTIGNFKPYYPWNAPPNENPYHARRGIKEHVIQNAFRKAQIQGLSMLATGGEP
RGDATSETSSDEDTGRQGSDVELESSDDELPYIDPNMEPVQQRPVMFVSRVPAKKPRKLP
WPTPKTHPVKRTNVKTSDRSDKAEAQSTPERPGPSEQSSVTVEPAHPTPVEMPMVILHQP
PPVPKPVPVKPTPPPSRRRRGACVVYDDDVIEVIDVETTEDSSSVSQPNKPHRKHQDGFQ
RSGRRQKRAAPPTVSPSDTGPPAVGPPAAGPPAAGPPAAGPPAAGPPAAGPPAAGPRILA
PLSAGPPAAGPHIVTPPSARPRIMAPPVVRMFMRERQLPQSTGRKPQCFWEMRAGREITQ
MQQEPSSHLQSATQPTTPRPSWAPSVCALSVMDAGKAQPIESSHLSSMSPTQPISHEEQP
RYEDPDAPLDLSLHPDVAAQPAPQAPYQGYQEPPAPQAPYQGYQEPPPPQAPYQGYQEPP
AHGLQSSSYPGYAGPWTPRSQHPCYRHPWAPWSQDPVHGHTQGPWDPRAPHLPPQWDGSA
GHGQDQVSQFPHLQSETGPPRLQLSLVPLVSSSAPSWSSPQPRAPIRPIPTRFPPPPMPL
QDSMAVGCDSSGTACPSMPFASDYSQGAFTPLDINATTPKRPRVEESSHGPARCSQATAE
AQEILSDNSEISVFPKDAKQTDYDASTESELD

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab