Index 
Search
Download
Help
MIX_00166: EBNA-3 nuclear protein
ID:

MIX_00166
AC:

166
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

EBNA-3 nuclear protein
EBNA-3A
GN:

BERF1
OS:

epstein-barr virus
P1:

2161150 (1990)
P2:

2161150 (1990)
SP:

EBN3_EBV, P12977
SS:

SWISSPROT/TrEMBL
SI:

812 AA; 88997 Da; calculated pI: 5.69
SQ:

MYIMYAMAIRQAIRDRRRNPASRRDQAKWRLQTLAAGWPMGYQAYSSWMYSYTDHQTTPT
FVHLQATLGCTGGRRCHVTFSAGTFKLPRCTPGDRQWLYVQSSVGNIVQSCNPRYSIFFD
YMAIHRSLTKIWEEVLTPDQRVSFMEFLGFLQRTDLSYIKSFVSDALGTTSIQTPWIDDN
PSTETAQAWNAGFLRGRAYGIDLLRTEGEHVEGATGETREESEDTESDGDDEDLPCIVSR
GGPKVKRPPIFIRRLHRLLLMRAGKRTEQGKEVLEKARGSTYGTPRPPVPKPRPEVPQSD
ETATSHGSAQVPEPPTIHLAAQGMAYPLHEQHGMAPCPVAQAPPTPLPPVSPGDQLPGVF
SDGRVACAPVPAPAGPIVRPWEPSLTQAAGQAFAPVRPQHMPVEPVPVPTVALERPVYPK
PVRPAPPKIAMQGPGETSGIRRARERWRPAPWTPNPPRSPSQMSVRDRLARLRAEAQVKQ
ASVEVQPPQLTQVSPQQPMEGPLVPEQQMFPGAPFSQVADVVRAPGVPAMQPQYFDLPLI
QPISQGAPVAPLRASMGPVPPVPATQPQYFDIPLTEPINQGASAAHFLPQQPMEGPLVPE
QWMFPGAALSQSVRPGVAQSQYFDLPLTQPINHGAPAAHFLHQPPMEGPWVPEQWMFQGA
PPSQGTDVVQHQLDALGYTLHGLNHPGVPVSPAVNQYHLSQAAFGLPIDEDESGEGSDTS
EPCEALDLSIHGRPCPQAPEWPVQEEGGQDATEVLDLSIHGRPRPRTPEWPVQGEGGQNV
TGPETRRVVVSAVVHMCQDDEFPDLQDPPDEA

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab