Index 
Search
Download
Help
MIX_00164: EBNA-2 nuclear protein
ID:

MIX_00164
AC:

164
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

EBNA-2 nuclear protein
GN:

BYRF1
OS:

epstein-barr virus
P1:

2161150 (1990)
P2:

2161150 (1990)
SP:

EBN2_EBV, P12978
SS:

SWISSPROT/TrEMBL
SI:

487 AA; 52485 Da; calculated pI: 6.53
SQ:

MPTFYLALHGGQTYHLIVDTDSLGNPSLSVIPSNPYQEQLSDTPLIPLTIFVGENTGVPP
PLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQRRDAWTQEPSPLDRDPLGY
DVGHGPLASAMRMLWMANYIVRQSRGDRGLILPQGPQTAPQARLVQPHVPPLRPTAPTIL
SPLSQPRLTPPQPLMMPPRPTPPTPLPPATLTVPPRPTRPTTLPPTPLLTVLQRPTELQP
TPSPPRMHLPVLHVPDQSMHPLTHQSTPNDPDSPEPRSPTVFYNIPPMPLPPSQLPPPAA
PAQPPPGVINDQQLHHLPSGPPWWPPICDPPQPSKTQGQSRGQSRGRGRGRGRGRGKGKS
RDKQRKPGGPWRPEPNTSSPSMPELSPVLGLHQGQGAGDSPTPGPSNAAPVCRNSHTATP
NVSPIHEPESHNSPEAPILFPDDWYPPSIDPADLDESWDYIFETTESPSSDEDYVEGPSK
RPRPSIQ

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab