Index 
Search
Download
Help
MIX_00162: Myc proto-oncogene protein
ID:

MIX_00162
AC:

162
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Myc proto-oncogene protein
c-myc
GN:

MYC
P1:

1992443 (1991), 2835733 (1987)
P2:

1992443 (1991), 2835733 (1987)
CC:

sequence taken from human
SP:

MYC_HUMAN, P01106
PD:

1A93, 1EE4, 2A93
SS:

SWISSPROT/TrEMBL
SI:

439 AA; 48750 Da; calculated pI: 5.33
SQ:

MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL
RKRREQLKHKLEQLRNSCA

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab