Index 
Search
Download
Help
MIX_00157: Nucleophosmin
ID:

MIX_00157
AC:

157
CL:

MIX
DT:

28-JUN-2003 (Rel. 2.2, created)
NA:

Nucleophosmin
NPM
Nucleolar phosphoprotein B23
Numatrin
Nucleolar protein NO38
GN:

NPM1
OS:

Gallus gallus (Chicken)
P1:

15169959 (2004)
P2:

1874752 (1991), 2026181 (1991), 2223875 (1990), 15169959 (2004), 14635188 (2003)
SP:

NPM_CHICK, P16039
SS:

SWISSPROT/TrEMBL
SI:

294 AA; 32632 Da; calculated pI: 4.66
SQ:

MEDSAMDMESMGPLRPQTFLFGCELKAEKEYQFKVDDEENEHQLSLRTVTLGAGAKDELH
VVEAEALDYEGNPTKVVLASLKMSVQPTVSLGGFEITPPFVLRLKCGSGPVYVSGQHLVA
LEEEPESEDEEEDTKIGNASTKRPASGGGAKTPQKKPKLSEDDEDDDEDEDDDEDDEDDL
DDDEEEIKTPMKKPAREPAGKNMQKAKQNGKDSKPSTPASKTKTPDSKKDKSLTPKTPKV
PLSLEEIKAKMQASVDKGCSLPKLEPKFANYVKNCFRTEDQKVIQALWQWRQTL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab