Index 
Search
Download
Help
MIX_00151: A-kinase anchor protein 8
ID:

MIX_00151
AC:

151
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

A-kinase anchor protein 8
A-kinase anchor protein 95 kDa
AKAP 95
GN:

AKAP8
AKAP95
OS:

Rattus norvegicus (Rat)
CT:

fibroblast
P1:

8125992 (1994)
P2:

10601332 (1999), 10791967 (2000), 8125992 (1994), 11279182 (2001), 14641107 (2004)
SP:

AKA8_RAT, Q63014
SS:

SWISSPROT/TrEMBL
SI:

687 AA; 76078 Da; calculated pI: 5.03
SQ:

MEQSYGGYGAWSAGPANTQGTYGSGVASWQGYENYSYYNAQNTSVPTGTPYSYGPASWEA
TKASDGGLAAGSSAMHVASFAPEPCTDNSDSLIAKINQRLDMLSKEGGRGGISSGGEGMQ
DRDSSFRFQPYESYDSRPCMPEHTPYRPSYSYDYDFDLGTDRNGSFGGTFNDCRDPTPER
GALDGFLRGRGQGRFQDRSNSSTFIRSDPFMPPSASSEPLSTTWSELNYMGGRGLGGPST
NRPPPSLFSQSMAPDYSMMGMQGVGGFGGTMPYGCGRSQTRIRDWPRRRGFERFGPDNMG
RKRKPFPLYEEPDAKLARADSEGDLSENDDGAGDLRSGDEEFRGEDDLCDSRKQRGEKED
EDEDVKKRREKQRRRDRMRDRAADRIQFACSVCKFRSFEDEEIQKHLQSKFHKETLRFIS
TKLPDKTVEFLQEYIINRNKKIEKRRQELLEKESPKPKPDPFKGIGQEHFFKRIEAAHCL
ACDMLIPAQHQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVLNNKHIVKMLEKYLKG
EDPFVNETADLETEGDENLGEEKETPEEVAAEVLAEVITAAVKAVEGDGEPAAEHSDVLA
EVEGPVDTAEAGSDSHTGKLLEEQTCETASETRNMEDMARGEAAEARNEAAVPAAAAGSP
VPVIAIPGILEDELEQTDAEAKDTPTE

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab