Index 
Search
Download
Help
MIX_00146: Nucleophosmin
ID:

MIX_00146
AC:

146
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Nucleophosmin
NPM
Nucleolar phosphoprotein B23
Numatrin
Nucleolar protein NO38
GN:

NPM1
OS:

Mus musculus (Mouse)
CT:

fibroblast
P1:

1874752 (1991)
P2:

1874752 (1991), 2026181 (1991), 2223875 (1990), 15169959 (2004), 14635188 (2003)
SP:

NPM_MOUSE, Q61937
SS:

SWISSPROT/TrEMBL
SI:

292 AA; 32524 Da; calculated pI: 4.62
SQ:

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDF
DEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPS
SVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab