Index 
Search
Download
Help
MIX_00143: Nuclear mitotic apparatus protein [Fragment]
ID:

MIX_00143
AC:

143
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Nuclear mitotic apparatus protein [Fragment]
GN:

NUMA
OS:

Homo sapiens (Human)
CT:

missing in: (spermatozoa, superficial keratinocytes, neutrophil granulocytes, syncytiotrophoblasts, some neurons, fibroblasts, smooth and skeletal muscle cell, breast cancer cell)
P1:

10739661 (2000), 7820866 (1994), 15003865 (2004)
P2:

8586651 (1995), 10739661 (2000), 7820866 (1994), 15003865 (2004)
CC:

caution: sequence is a fragment only
SP:

Q9UPG3
SS:

SWISSPROT/TrEMBL
SI:

173 AA; 19591 Da; calculated pI: 4.93
SQ:

KLADDLSTLQEKMAATSKEVARLETLVRKAGEQQETASRELVKEPARAGDRQPEWLEEQQ
GRQFCSTQAALQAMEREAEQMGNELERLRAALMESQGQQQEERGQQEREVARLTQERGRA
QADLALEKAARAELEMRLQNALNEQRVEFATLQEALAHALTEKEGKDQELAKL

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab