Index 
Search
Download
Help
MIX_00142: REV protein
ID:

MIX_00142
AC:

142
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

REV protein
Anti-repression transactivator protein
ART/TRS
GN:

REV
OS:

hiv-1
CT:

mouse cell
P1:

1667585 (1991)
P2:

1667585 (1991)
SP:

REV_HV1S1, P19548
SS:

SWISSPROT/TrEMBL
SI:

116 AA; 12971 Da; calculated pI: 9.68
SQ:

MAGRSGDSDEELLQTVRFIKFLYQSNPLPSPKGTRQARRNRRRRWRERQRQIQSISAWII
STHLGRSTEPVPLQLPPLERLNLDCSEDCGTSGTQGVGSPQVLGESPAVLDSGTKE

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab