Index 
Search
Download
Help
MIX_00141: Cyclin-dependent kinase inhibitor 1
ID:

MIX_00141
AC:

141
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Cyclin-dependent kinase inhibitor 1
p21
CDK-interacting protein 1
Melanoma differentiation associated protein 6
MDA-6
GN:

CDKN1A
CDKN1
CIP1
WAF1
MDA6
SDI1
PIC1
CAP20
OS:

Rattus norvegicus (Rat)
CT:

liver
P1:

8895483 (1996), 9045936 (1996)
P2:

8895483 (1996), 9045936 (1996)
CC:

sequence taken from mouse
SP:

CDNA_HUMAN, P38936
PD:

1AXC
SS:

SWISSPROT/TrEMBL
SI:

164 AA; 18099 Da; calculated pI: 8.69
SQ:

MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab