Index 
Search
Download
Help
MIX_00134: Erythroid transcription factor
ID:

MIX_00134
AC:

134
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Erythroid transcription factor
GATA-1
Eryf1
NF-E1 DNA-binding protein
NF-E1A
GN:

GATA1
ERYF1
OS:

Gallus gallus (Chicken)
CT:

erythrocytes, erythroid cell
P1:

8891891 (1996), 8089200 (1994)
P2:

8891891 (1996), 8089200 (1994)
SP:

GAT1_CHICK, P17678
PD:

1GAT, 1GAU, 2GAT, 3GAT
SS:

SWISSPROT/TrEMBL
SI:

304 AA; 31381 Da; calculated pI: 9.50
SQ:

MEFVALGGPDAGSPTPFPDEAGAFLGLGGGERTEAGGLLASYPPSGRVSLVPWADTGTLG
TPQWVPPATQMEPPHYLELLQPPRGSPPHPSSGPLLPLSSGPPPCEARECVNCGATATPL
WRRDGTGHYLCNACGLYHRLNGQNRPLIRPKKRLLVSKRAGTVCSNCQTSTTTLWRRSPM
GDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKVSSKGKKRRPPGGGNPSATAGGGAPM
GGGGDPSMPPPPPPPAAAPPQSDALYALGPVVLSGHFLPFGNSGGFFGGGAGGYTAPPGL
SPQI

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab