Index 
Search
Download
Help
MIX_00113: Polypyrimidine tract-binding protein 1
ID:

MIX_00113
AC:

113
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Polypyrimidine tract-binding protein 1
PTB
Heterogeneous nuclear ribonucleoprotein I
hnRNP I
57 kDa RNA-binding protein PPTB-1
GN:

PTBP1
PTB
OS:

Homo sapiens (Human)
P1:

10653975 (2000)
P2:

10653975 (2000)
SP:

PTB_HUMAN, P26599
PD:

1QM9
SS:

SWISSPROT/TrEMBL
SI:

531 AA; 57156 Da; calculated pI: 9.22
SQ:

MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRV
IHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPV
LRGQPIYIQFSNHKELKTDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQ
SPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLS
LDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLS
VPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGV
YGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPREG
QEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGV
VKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab