Index 
Search
Download
Help
MIX_00111: Proteasome subunit beta type 1-A
ID:

MIX_00111
AC:

111
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Proteasome subunit beta type 1-A
20S proteasome beta 6 subunit A
B6-A
OS:

goldfish
CT:

oocyte
P1:

10781806 (2000)
P2:

10781806 (2000)
CC:

subunit types A and B mentioned in paper through #AA
SP:

PS11_CARAU, Q9IB84
SS:

SWISSPROT/TrEMBL
SI:

238 AA; 26145 Da; calculated pI: 6.52
SQ:

MMISAQACGANGRMKDYHYTGPVEHKFSPYAFNGGTVLAVAGEDFALVASDTRLSEGYSI
HSRDSPKCYKLTDTTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKSMTSGAIAAMLSTI
LYGRRFFPYYVYNIIGGLDEEGRGAVYSFDPVGSYQRDTYKAGGSASAMLQPLLDNQIGF
KNMENVEQVPLSQEKAVQLVKDVFISAAERDVYTGDALKICIITKEGIREEIVPLRKD

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab