Index 
Search
Download
Help
MIX_00103: 53 kDa BRG1-associated factor A
ID:

MIX_00103
AC:

103
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

53 kDa BRG1-associated factor A
Actin-related protein Baf53a
ArpNbeta
GN:

BAF53A
BAF53
OS:

Homo sapiens (Human)
CT:

HeLa cell
P1:

11266125 (2001)
P2:

11266125 (2001)
CC:

36% identity and 50% similarity with the human beta-actin
SP:

B53A_HUMAN, O96019
SS:

SWISSPROT/TrEMBL
SI:

429 AA; 47407 Da; calculated pI: 5.39
SQ:

MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDK
GKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPV
LMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAI
PVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRK
EKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAE
RLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSF
TDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGG
KQCVERKCP

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab