Index 
Search
Download
Help
MIX_00099: Paired box protein Pax-2
ID:

MIX_00099
AC:

99
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Paired box protein Pax-2
GN:

PAX2
P1:

10908331 (2000)
P2:

10908331 (2000)
CC:

sequence taken from human
SP:

PAX2_HUMAN, Q02962
SS:

SWISSPROT/TrEMBL
SI:

416 AA; 44684 Da; calculated pI: 7.76
SQ:

MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV
SHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLA
EGICDNDTVPSVSSINRIIRTKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASND
PVGSYSINGILGIPRSNGEKRKRDEVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVPNGDS
QSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGL
DEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAG
MVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLSSPYYYSAAPRSAPAARAAAYDRH

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab