Index 
Search
Download
Help
MIX_00094: Polyadenylate-binding protein 1
ID:

MIX_00094
AC:

94
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Polyadenylate-binding protein 1
Poly(A)-binding protein 1
PABP 1
GN:

PABPC1
PABP1
PAB1
OS:

Homo sapiens (Human)
CT:

HeLa
P1:

9925762 (1999)
P2:

9925762 (1999)
SP:

PAB1_HUMAN, P11940
PD:

1CVJ, 1G9L
SS:

SWISSPROT/TrEMBL
SI:

636 AA; 70590 Da; calculated pI: 9.52
SQ:

MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN
LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVAT
KPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA
AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
RVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQ
GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESP
ESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab