Index 
Search
Download
Help
MIX_00091: Neighbor of A-kinase anchoring protein 95
ID:

MIX_00091
AC:

91
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Neighbor of A-kinase anchoring protein 95
Homologous to AKAP95 protein
HA95
Helicase A-binding protein 95
HAP95
HRIHFB2018
GN:

NAKAP95
OS:

Homo sapiens (Human)
P1:

11034899 (2000), 12950172 (2003)
P2:

11034899 (2000), 12950172 (2003)
SP:

NA95_HUMAN, Q9ULX6
SS:

SWISSPROT/TrEMBL
SI:

646 AA; 71570 Da; calculated pI: 4.97
SQ:

MSYTGFVQGSETTLQSTYSDTSAQPTCDYGYGTWNSGTNRGYEGYGYGYGYGQDNTTNYG
YGMATSHSWEMPSSDTNANTSASGSASADSVLSRINQRLDMVPHLETDMMQGGVYGSGGE
RYDSYESCDSRAVLSERDLYRSGYDYSELDPEMEMAYEGQYDAYRDQFRMRGNDTFGPRA
QGWARDARSGRPMASGYGRMWEDPMGARGQCMSGASRLPSLFSQNIIPEYGMFQGMRGGG
AFPGGSRFGFGFGNGMKQMRRTWKTWTTADFRTKKKKRKQGGSPDEPDSKATRTDCSDNS
DSDNDEGTEGEATEGLEGTEAVEKGSRVDGEDEEGKEDGREEGKEDPEKGALTTQDENGQ
TKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYV
GTKLPKQTADFLQEYVTNKTKKTEELRKTVEDLDGLIHQIYRDQDLTQEIAMEHFVKKVE
AAHCAACDLFIPMQFGIIQKHLKTMDHNRNRRLMMEQSKKSSLMVARSILNNKLISKKLE
RYLKGENPFTDSPEEEKEQEEAEGGALDEGAQGEAAGISEGAEGVPAQPPVPPEPAPGAV
SPPPPPPPEEEEEGAVPLLGGALQRQIRGIPGLDVEDDEEGGGGAP

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab