Index 
Search
Download
Help
MIX_00090: Cellular tumor antigen p53
ID:

MIX_00090
AC:

90
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Cellular tumor antigen p53
Tumor suppressor p53
GN:

TP53
TRP53
P53
OS:

Mus musculus (Mouse)
CT:

kidney cell, sv-40 transformed cell, viral and non-viral transformed cell
P1:

2839350 (1988), 3023923 (1986), 11571642 (2001)
P2:

2839350 (1988), 3023923 (1986), 8720437 (1995), 10502301 (1999), 10813394 (2000), 11389540 (2000), 11571642 (2001), 11821948 (2002)
CC:

this NMTS is a close homologue (hssp >= 10) to NMTS found in literature
SP:

P53_MOUSE, P02340
PD:

1HU8
SS:

SWISSPROT/TrEMBL
SI:

390 AA; 43409 Da; calculated pI: 6.83
SQ:

MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEA
LRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVM
CTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCS
DGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCM
GGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGS
AKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSR
AHSSYLKTKKGQSTSRHKKTMVKKVGPDSD

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab