Index 
Search
Download
Help
MIX_00071: Vitamin D3 receptor
ID:

MIX_00071
AC:

71
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Vitamin D3 receptor
VDR
1,25-dihydroxyvitamin D3 receptor
GN:

VDR
NR1I1
OS:

Rattus norvegicus (Rat)
CT:

genitourinary tissue
P1:

9744521 (1998)
P2:

9744521 (1998)
SP:

VDR_RAT, P13053
SS:

SWISSPROT/TrEMBL
SI:

423 AA; 47759 Da; calculated pI: 5.88
SQ:

MEATAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMIMKRKEEEALKDSL
RPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSYSPRPTLSFSGNSSS
SSSDLYTTSLDMMEPSGFSNLDLNGEDSDDPSVTLDLSPLSMLPHLADLVSYSIQKVIGF
AKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAG
HTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQ
TYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGN
EIS

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab