Index 
Search
Download
Help
MIX_00070: CCAAT Displacement Protein
ID:

MIX_00070
AC:

70
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

CCAAT Displacement Protein
CDP
Cut-like 1
Homeobox protein Cux
GN:

CUTL1
CUX
OS:

Mus musculus (Mouse)
CT:

t-cell
P1:

9218488 (1997)
P2:

9218488 (1997)
CC:

caution: sequence is a fragment only
SP:

CUT1_MOUSE, P53564
SS:

SWISSPROT/TrEMBL
SI:

1395 AA; 151633 Da; calculated pI: 5.86
SQ:

TLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKSQAETIALEKEQKLQNDFAEKERKLQ
ETQMSTTSKLEEAEHKLQTLQTALEKTRTELFDLKTKYDEETTAKADEIEMIMTDLERAN
QRAEVAQREAETLREQLSSANHSLQLASQIQKAPDVAIEVLTRSSLEVELAAKEREIAQL
VEDVQRLQASLTKLRENSASQISQLEQQLNAKNSTLKQLEEKLKGQADYEEVKKELNTLK
SMEFAPSEGAGTQDSTKPLEVLLLEKNRSLQSENATLRISNSDLSGSARRKGRDQPESRR
PGPLPASPPPQLPRNTGEQVSNTNGTHHFSPAGLSQDFFSSNLASPSLPLASTGKFALNS
LLQRQLMQSFYSKAMQEAGSTSTIFSTGPYSTNSISSPSPLQQSPDVNGMAPSPSQSESA
GSISEGEEIDTAEIARQVKEQLIKHNIGQRIFGHYVLGLSQGSVSEILARPKPWNKLTVR
GKEPFHKMKQFLSDEQNILALRSIQGRQRENPGQSLNRLFQEVPKRRNGSEGNITTRIRA
SETGSDEAIKSILEQAKRELQVQKTAEPVQTSSTSSSGNSDDAIRSILQQARREMEAQQA
ALDPALKPAPLSQPDLTILTPKHLSASPMSTVSTYPPLAISLKKTPAAPETSTAALPSAP
ALKKEAQDVPTLDPPGSADAAQGVLRPMKSELVRGSTWKDPWWSPIQPERRNLTSSEETK
ADETTASGKERAGSSQPRAERSQLQGPSASAEYWKEWPSAESPYSQSSELSLTGASRSET
PQNSPLPSSPIVPMAKPAKPSVPPLTPEQYEVYMYQEVDTIELTRQVKEKLAKNGICQRI
FGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQLWLNGELGQGVLPVQGQQQGPV
LHSVASLQDPLQQGCVSSESTPKTSASCSPAPESPMSSSESVKSLTELVQQPCPAIETSK
EGKPPEPSDPPASDSQPTTPLPLSGHSALSIQELVAMSPELDTYGITKRVKEVLTDNNLG
QRLFGETILGLTQGSVSDLLARPKPWHKLSLKGREPFVRMQLWLNDPNNVEKLMDMKRME
KKAYMKRRHSSVSDSQPCEPPSVGIDYSQGASPQPQHQLKKPRVVLAPEEKEALKRAYQQ
KPYPSPKTIEELATQLNLKTSTVINWFHNYRSRIRRELFIEEIQAGSQGQAGASDSPSAR
SSRAAPSSEGDSCDGVEATDAEEPGGNIVATKSQGGLAEVAAAPADREEATQPAEKAKAQ
PLCSGTPGQDDGEDASRPRPLPEGLADAPAPVPSLAAPAAGEDAATSATAPATATEAPGA
ARAGPAERSSALPSTSAPANAPARRPSSLQSLFGLPEAAGARDNPVRKKKAANLNSIIHR
LEKAASREEPIEWEF

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab