Index 
Search
Download
Help
MIX_00069: Transcription factor ELYS
ID:

MIX_00069
AC:

69
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Transcription factor ELYS
Embryonic large molecule derived from yolk sac
GN:

ELYS
AV011447
6230412P20RIK
OS:

Mus musculus (Mouse), Homo sapiens (Human)
CT:

foetal haematopoietic cell
P1:

11952839 (2002)
P2:

11952839 (2002)
CC:

same sequence for mouse (Q8VD55) and human (BAB78517.1)
SP:

Q8VD55
SS:

SWISSPROT/TrEMBL
SI:

2243 AA; 247367 Da; calculated pI: 6.13
SQ:

MQDLTAQVTSDLLHFPEVTIEALGEDEITLESVLRGKFAAGKNGLACLACGPQLEVVNSL
TGERLSAYRFSGVNEQPPVVLAVKEFSWHKRTGLLIGLEEADGSVLCLYDLGISRVVKAV
VLPGRVTAIEPIINHGGASASTQHLHPSLRWLFGVAAVVTDVGQILLIDLCLDDLSCSQN
EVEASDLEVITGIPAEVPHIRERVMREGRHLCFQLVSPLGVAISTLSYINRTNQLAVGFS
DGYLALWNMKSMKREYYTQLEGGRVPVHAVAFQEPENDPRNCCYLWAVQSTQDSEGDVLS
LHLLQLAFGDRKCLASGQILYEGLEYCEERYTLDLAGGTFPLRGQTSNTKLLGCQSIERF
PSHGDREESMREALSPDTSVSVFTWQVNIYGQGKPSVYLGLFDINRWYHAQMPDSLRSGE
SLHNCSYFALWSLDSVVSRTSPHHILDILVHERSLNRGVPPSYPPPEQFFNPSTFNFDAT
CLLDSGVIHVTCAGFQKETLTFLKKSGPTLNEVIPDSYNRCLVAGLLSPRLIDIQPSSLS
QEEQLEAILSAAIQTSSLGLLTGYIRTWIIEEQPNSAANLRFVLEWTWNKVVLTKEEFDR
LCVPLFDGSCRFIDPQTIQSIQQCHLLLSNLSTVLSCFAMEAQGITERGLVDLSNKHMVT
QLLCQYAHMVLWFCHSGLLPEGLDDALQLSRLRYNYPVIQNYYTSRRQKSERSPRGKWNH
DCLMIDGLVSQLGDEVEKLWKRDEGGTGRYPPASIHALLDIYLLDNITEASKHAITIYLL
LDIMYSFPNKTDTPIESFPTAFAISWGQVKLVQGFWLLDHNDYENGLDLLFHPVTAKPAS
WQHSKIIEAFMSQGEHKQALRYLQTMKPTVSSSNEVILHLTVLLFNRCMVEAWNLLRQNS
NRVNIEELLKHAYEVCQEMGLMEDLLKLPFTNTEQECLVKFLQSSTSVENHEFLLVHHLQ
RANYISALKLNQILKNNLMSDRDPRLRERSVTRNSILDQYGKILPRVQRKLAVERAKPYH
LSTSSVFHEVSRPKPLSAFPKKAITGTVLTRSTFISNVLSKIGEVWASHEPRNGVSLFNS
PKTEQPSPVVHSFPHPELPEAFVGTPISNTSQRISRLLDLVVHPVPQPSQCLEFIQQSPT
RSPLCLLSSSLPLSSQFKRPHQNTSRPSELLLLETPLIVKKAKSLALSATSSGFAEFTPP
SILRSGLRTTPLASPSLSPGRSLTPPFRVKETRISFMEEGMNTHWTDRATDDRNTKAFVS
TSFHKCGLPAETEWMKTSDKNTYFPLDVPAKGPQKVVAESLATHSGRLEKLDVSKEDSTA
STRSDQTSLEYHDAPSPEDLEGAVFVSPKPASSSTELTTNSTLQTERDNDKDAFKSEGTP
SPVKKQIGTGDAAVEAFSELSRLDPVERAEASFGVSSVCEGETSTSNSKTSVLDGIVPIE
SRTSILTADHKESVANTVADVESSGSTSSKCPVTSERSLGQKLTLNLKEDEIEAHVPKEN
VGLPEESPRISAAPSDTHEIHLIGCENLEVQNSEEEAKNLSFDELYPLGAEKLEYNLSTI
EQQFCDLPDDKDSAECDAAEVDGELFVAQSNFTLILEGEEGEAEASDSAAPNMLPKATKE
KPVCHREPHNQERVTDLPSAVTADQESHKVETLPYVPEPVKVAIAENLLDVIKDTRSKEA
TPVAAGEAGDEDGAVIVSKAAHSSRLTNSTPKTVKEPRAETVNTSQNDDMVSSRTLTRRQ
HALSLNVTSEQEPSAVATPKKRTRKIKETPESSERTCSDLKVAPENQLTAQSPPAPRRGK
KKDVSQGTLPSSGAVEPEPEPQGTPGRLRLRTQPPEPAAEETPSRTKVRLSSVRKGTPRR
LKKSVENGQSTEILDDLKGSEAASHDGTVTELRNANLEDTQNMEYKQDEHSDQQLPLKRK
RVREREVSVSSVTEEPKLDSSQLPLQTGLDVPATPRKRGRPRKVVPLEADGGTTGKEQTS
PQKKDVPVVRRSTRNTPARNVSTLEKSVLVPNKEAALVVTSKRRPTKKSAEESSKDPSAA
VSDLAGGAAHTESADRRDGLLAAAALTPSAQGTRTRSRRTMLLTDISEPKTEPLFPPPSV
KVPKKKSKAENMEAAAQLKELVSDLSSQFVVSPPALRTRQKSISNTSKLLGELESDPKPL
EIIEQKPKRSRTVKTRASRNTGKGSSWSPPPVEIKLVSPLASPVDEIKTGKPRKTAEIAG
KTLGRGRKKPSSFPKQILRRKML

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab