Index 
Search
Download
Help
MIX_00068: Vitamin D3 receptor
ID:

MIX_00068
AC:

68
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Vitamin D3 receptor
VDR
1,25-dihydroxyvitamin D3 receptor
GN:

VDR
NR1I1
OS:

Homo sapiens (Human)
CT:

genitourinary tissue
P1:

9744521 (1998)
P2:

9744521 (1998)
SP:

VDR_HUMAN, P11473
PD:

1DB1, 1IE8, 1IE9, 1KB2, 1KB4, 1KB6
SS:

SWISSPROT/TrEMBL
SI:

427 AA; 48234 Da; calculated pI: 6.08
SQ:

MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
RPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSG
DSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQK
VIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDV
TKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLS
NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
VFGNEIS

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab