Index 
Search
Download
Help
MIX_00065: Transcriptional repressor protein YY1
ID:

MIX_00065
AC:

65
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Transcriptional repressor protein YY1
Yin and Yang 1
Yin Yang 1
YY-1
Delta transcription factor
NF-E1
GN:

YY1
OS:

Homo sapiens (Human)
CT:

osteosarcoma ROS 17/2.8 cell
P1:

7479833 (1995), 9215534 (1997), 9493911 (1998), 10675569 (2000)
P2:

7479833 (1995), 9215534 (1997), 9493911 (1998), 10675569 (2000)
CC:

NMTS contains some Zink-fingers
SP:

TYY1_HUMAN, P25490
PD:

1UBD, 1ZNM
SS:

SWISSPROT/TrEMBL
SI:

414 AA; 44663 Da; calculated pI: 5.80
SQ:

MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHG
GGGGHGHAGHHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDG
LRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKS
GKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEE
QIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH
KGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGC
GKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab