Index 
Search
Download
Help
MIX_00057: Ribonuclease H1
ID:

MIX_00057
AC:

57
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

Ribonuclease H1
RNase H1
Ribonuclease H type II
GN:

RNASEH1
RNH1
OS:

Rattus norvegicus (Rat)
CT:

liver
P1:

3027082 (1987)
P2:

3027082 (1987)
CC:

sequence taken from human
SP:

RNH1_HUMAN, O60930
SS:

SWISSPROT/TrEMBL
SI:

286 AA; 32028 Da; calculated pI: 9.28
SQ:

MSWLLFLAHRVALAALPCRRGSRGFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKK
FATEDEAWAFVRKSASPEVSEGHENQHGQESEAKASKRLREPLDGDGHESAEPYAKHMKP
SVEPAPPVSRDTFSYMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQ
TNQRAEIHAACKAIEQAKTQNINKLVLYTDSMFTINGITNWVQGWKKNGWKTSAGKEVIN
KEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab