Index 
Search
Download
Help
MIX_00041: DNA polymerase alpha catalytic subunit
ID:

MIX_00041
AC:

41
CL:

MIX
DT:

23-MAY-2003 (Rel. 1.0, created)
NA:

DNA polymerase alpha catalytic subunit
GN:

POLA
POLA1
OS:

Mus musculus (Mouse)
CT:

erythroleukemia cell
P1:

8374595 (1993)
P2:

3272344 (1988), 3676271 (1987), 3756167 (1986), 8374595 (1993), 1325438 (1992), 1639141 (1992), 1647771 (1991), 1903085 (1991), 1935940 (1991), 2152802 (1990), 2930545 (1989), 2995410 (1985)
CC:

sequence taken of catalytic subunit (because "activity" was mentioned in paper)
SP:

DPOA_MOUSE, P33609
SS:

SWISSPROT/TrEMBL
SI:

1465 AA; 167148 Da; calculated pI: 5.53
SQ:

MAPMHEEDCKLEASAVSDSGSFAASRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDL
TSVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDTCGKGSDGK
AHRKDRKDVKKPSVTKPNNIKAMFIASAGKKTTDKAVDLSKDDLLGDILQDLNTETAQIT
PPPVLIPKKKRSTGALLNPFSVHTPKAIPSGKPASPVLRNEPLLTPIPLKRAELAGELAQ
PECPEDEQELGVMEFEDGDFDESMDTEKVDEKPVTAKTWDQETEPVERVEHEADPERGTT
SYLENFLPDVSCWDIDQDDESIPQEVQVDSSNLPLVKGADDEQVFQFYWLDAYEDPYNQP
GVVFLFGKVWIESVKTHVSCCVMVKNIERTLYFLPREMKFDLNTGKETAIPVTMKDVYEE
FDSKISAKYKIMKFKSKIVEKNYAFEIPDVPEKSEYLEVRYSAEVPQLPQNLKGETFSHV
FGTNTSSLELFLMNRKIKGPCWLEVKNPQLLNQPISWCKFEVMALKPDLVNVIKDVSPPP
LVVMSFSMKTMQNVQNHQHEIIAMAALVHHSFALDKAPPEPPFQTHFCVVSKPKDCIFPC
DFKEVISKKNMKVEIAATERTLIGFFLAKVHKIDPDILVGHNICSFELEVLLQRINECKV
PYWSKIGRLRRSNMPKLGSRSGFGERNATCGRMICDVEISAKELIHCKSYHLSELVQQIL
KTERIVIPTENIRNMYSESSYLLYLLEHIWKDARFILQIMCELNVLPLALQITNIAGNIM
SRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKK
ATYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVTSEVQKATEDEEQE
QIPELPDPNLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLVLQYDIRQKALKLTANSM
YGCLGFSYSRFYAKPLAALVTYKGREILMHTKDMVQKMNLEVIYGDTDSIMINTNSTNLE
EVFKLGNKVKSEVNKLYKLLEIDIDAVFKSLLLLKKKKYAALVVEPTSDGNYITKQELKG
LDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQFEIN
KALTKDPQDYPDRKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLTATQRAYAPE
QLQKLDNLAIDTQYYLAQQIHPVVARICEPIDGIDAVLIALWLGLDSTQFRVHQYHKDEE
NDALLGGPAQLTDEEKYKDCEKFKCLCPSCGTENIYDNVFEGSGLDMEPSLYRCSNVDCK
VSPLTFMVQLSNKLIMDIRRCIKKYYDGWLICEEPTCCSRLRRLPLHFSRNGPLCPVCMK
AVLRPEYSDKSLYTQLCFYRYIFDADCALEKLTEHEKDKLKKQFFPLRVLQDYRKVKNIA
EQFLSWSGYSEVNLSKLFANYAGKS

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab