Index 
Search
Download
Help
MIX_00039: Proliferating cell nuclear antigen
ID:

MIX_00039
AC:

39
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Proliferating cell nuclear antigen
PCNA
Cyclin
GN:

PCNA
OS:

Homo sapiens (Human)
CT:

hematopoietic cell
P1:

10022607 (1999)
P2:

11425231 (2001), 10022607 (1999), 9729238 (1998)
SP:

PCNA_HUMAN, P12004
PD:

1AXC
SS:

SWISSPROT/TrEMBL
SI:

261 AA; 28736 Da; calculated pI: 4.57
SQ:

MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab