Index 
Search
Download
Help
MIX_00028: Progesterone receptor
ID:

MIX_00028
AC:

28
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Progesterone receptor
PR
GN:

PGR
NR3C3
OS:

avian
CT:

oviduct
P1:

10651641 (2000), 8701093 (1996)
P2:

8701093 (1996), 10651641 (2000)
CC:

this NMTS is a close homologue (hssp >= 10) to NMTS found in literature
SP:

PRGR_CHICK, P07812
SS:

SWISSPROT/TrEMBL
SI:

786 AA; 85646 Da; calculated pI: 5.07
SQ:

MTEVKSKETRAPSSARDGAVLLQAPPSRGEAEGIDVALDGLLYPRSSDEEEEEEENEEEE
EEEEPQQREEEEEEEEEDRDCPSYRPGGGSLSKDCLDSVLDTFLAPAAHAAPWSLFGPEV
PEVPVAPMSRGPEQKAVDAGPGAPGPSQPRPGAPLWPGADSLNVAVKARPGPEDASENRA
PGLPGAEERGFPERDAGPGEGGLAPAAAASPAAVEPGAGQDYLHVPILPLNSAFLASRTR
QLLDVEAAYDGSAFGPRSSPSVPAADLAEYGYPPPDGKEGPFAYGEFQSALKIKEEGVGL
PAAPPPFLGAKAAPADFAQPPRAGQEPSLECVLYKAEPPLLPGAYGPPAAPDSLPSTSAA
PPGLYSPLGLNGHHQALGFPAAVLKEGLPQLCPPYLGYVRPDTETSQSSQYSFESLPQKI
CLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRK
CCQAGMVLGGRKFKKLNKMKVVRTLDVALQQPAVLQDETQSLTQRLSFSPNQEIPFVPPM
ISVLRGIEPEVVYAGYDNTKPETPSSLLTSLNHLCERQLLCVVKWSKLLPGFRNLHIDDQ
ITLIQYSWMSLMVFAMGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLSMWQLPQE
FVRLQVSQEEFLCMKALLLLNTIPLEGLRSQSQFDEMRTSYIRELVKAIGLRQKGVVANS
QRFYQLTKLMDSMHDLVKQLHLFCLNTFLQSRALSVEFPEMMSEVIAAQLPKILAGMVKP
LLFHKK

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab