Index 
Search
Download
Help
MIX_00027: Proliferating cell nuclear antigen
ID:

MIX_00027
AC:

27
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Proliferating cell nuclear antigen
PCNA
GN:

PCNA
OS:

Cricetulus griseus (Chinese hamster)
CT:

CHO cell
P1:

9729238 (1998), 11425231 (2001)
P2:

11425231 (2001), 10022607 (1999), 9729238 (1998)
SP:

PCNA_CRIGR, P57761
SS:

SWISSPROT/TrEMBL
SI:

261 AA; 28762 Da; calculated pI: 4.57
SQ:

MFEARLVQGSILKKVLEALKDLINEACWDISSGGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSTDVPLVVEYK
ISDMGHLKYYLAPKIEDEEGS

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab