Index 
Search
Download
Help
MIX_00021: Basic fibroblast growth factor receptor 1 [Precursor]
ID:

MIX_00021
AC:

21
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Basic fibroblast growth factor receptor 1 [Precursor]
FGFR-1
bFGF-R
MFR
GN:

FGFR1
FLG
OS:

Rattus norvegicus (Rat)
CT:

reactive astrocyte
P1:

9457702 (1997)
P2:

8737680 (1996), 8856671 (1996), 9457702 (1997)
SP:

FGR1_RAT, Q04589
SS:

SWISSPROT/TrEMBL
SI:

822 AA; 91720 Da; calculated pI: 5.74
SQ:

MWGWRGLLFWAVLVTATLCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVRDSIPADSGLYACVTNSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPSPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYDQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIIYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPNPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWNAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQDSPSF
PDTRSSTCSSGEDSVFSHEPFPEEPCLPRHPTQLANGGLNRR

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab