Index 
Search
Download
Help
MIX_00011: Cellular tumor antigen p53
ID:

MIX_00011
AC:

11
CL:

MIX
DT:

22-MAY-2003 (Rel. 1.0, created)
NA:

Cellular tumor antigen p53
Tumor suppressor p53
GN:

TP53
OS:

Xenopus Laevis (African claw frog)
CT:

egg cell
P1:

10502301 (1999)
P2:

2839350 (1988), 3023923 (1986), 8720437 (1995), 10502301 (1999), 10813394 (2000), 11389540 (2000), 11571642 (2001), 11821948 (2002)
SP:

P53_XENLA, P07193
SS:

SWISSPROT/TrEMBL
SI:

363 AA; 40646 Da; calculated pI: 6.16
SQ:

MEPSSETGMDPPLSQETFEDLWSLLPDPLQTVTCRLDNLSEFPDYPLAADMTVLQEGLMG
NAVPTVTSCAVPSTDDYAGKYGLQLDFQQNGTAKSVTCTYSPELNKLFCQLAKTCPLLVR
VESPPPRGSILRATAVYKKSEHVAEVVKRCPHHERSVEPGEDAAPPSHLMRVEGNLQAYY
MEDVNSGRHSVCVPYEGPQVGTECTTVLYNYMCNSSCMGGMNRRPILTIITLETPQGLLL
GRRCFEVRVCACPGRDRRTEEDNYTKKRGLKPSGKRELAHPPSSEPPLPKKRLVVVDDDE
EIFTLRIKGRSRYEMIKKLNDALELQESLDQQKVTIKCRKCRDEIKPKKGKKLLVKDEQP
DSE

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab