Index 
Search
Download
Help
ASC_00435: Homeobox protein prophet of Pit-1
ID:

ASC_00435
AC:

435
CL:

ASC
DT:

15-JUL-2004 (Article found)
NA:

Homeobox protein prophet of Pit-1
PROP-1
Pituitary specific homeodomain factor
GN:

PROP1
OS:

Homo sapiens (Human)
P1:

15246537 (2004)
P2:

15246537 (2004)
SP:

PRH1_HUMAN, O75360
SS:

SWISSPROT/TrEMBL
SI:

226 AA; 24957 Da; calculated pI: 10.36
SQ:

MEAERRRQAEKPKKGRVGSSLLPERHPATGTPTTTVDSSAPPCRRLPGAGGGRSRFSPQG
GQRGRPHSRRRHRTTFSPVQLEQLESAFGRNQYPDIWARESLARDTGLSEARIQVWFQNR
RAKQRKQERSLLQPLAHLSPAAFSSFLPESTACPYSYAAPPPPVTCFPHPYSHALPSQPS
TGGAFALSHQSEDWYPTLHPAPAGHLPCPPPPPMLPLSLEPSKSWN

View entry in original NMP-db format
View entry in raw text format (no links)


Rostlab